SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017512 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017512
Domain Number 1 Region: 25-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000476
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017512   Gene: ENSPTRG00000010301   Transcript: ENSPTRT00000018923
Sequence length 282
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:4315342:4326307:-1 gene:ENSPTRG00000010301 transcript:ENSPTRT00000018923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQAPAWERLRVKWT
KDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVNLNHSGAYVCWAAVEIPE
LEEAESNITRLFVDPDDPTQNRNRITSFPGFLFVLLGVGSGAVAAIVLGAWFWGRRSCQQ
RDSGNSPGNAFYSNVLYRPRGAPKKSEDCSGEGKDQRGQSIYSTSFPQPATRQPHLAPRP
CPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVGEE
Download sequence
Identical sequences H2QF12
ENSPTRP00000017512 ENSPTRP00000017512 9598.ENSPTRP00000017512 XP_001138228.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]