SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017513 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017513
Domain Number 1 Region: 292-402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-21
Family SPRY domain 0.0062
Further Details:      
 
Domain Number 2 Region: 98-208
Classification Level Classification E-value
Superfamily Fibronectin type III 1.59e-17
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017513   Gene: ENSPTRG00000010302   Transcript: ENSPTRT00000018924
Sequence length 423
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:4328629:4347856:1 gene:ENSPTRG00000010302 transcript:ENSPTRT00000018924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQEALRKIIKTLAVKNEEIQSFIYSLKQMLLNVEANSAKVHEDLEAQFQSLFSLLAAKQ
IKDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPVIDLAESLVAD
NCVTLVWRMPDEDSKIDHYVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDM
KYMNFRVKACNKAVAGEFSEPVTLETPAFMRLDASTSHQNMRVDDLSVEWDAMGGKVQDI
KAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAESYTVLVRYEPDSKAFGVGV
AYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKVKVLDAPVPDCLGVHCDFHQGLL
SFYNARTKQVLHTFKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRCLQKRGSATSSSNT
SLT
Download sequence
Identical sequences ENSPTRP00000017513 ENSPTRP00000017513 9598.ENSPTRP00000017513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]