SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017533 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017533
Domain Number 1 Region: 71-343
Classification Level Classification E-value
Superfamily L domain-like 3.4e-50
Family Ngr ectodomain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017533   Gene: ENSPTRG00000010314   Transcript: ENSPTRT00000018944
Sequence length 347
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:4558030:4560885:-1 gene:ENSPTRG00000010314 transcript:ENSPTRT00000018944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPA
EIPSYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLQPVPQLRV
LDLTRNALTGLPPGLFQASAALDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLP
PGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRY
LFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Download sequence
Identical sequences H2QF21
9598.ENSPTRP00000017533 ENSPTRP00000017533 XP_001139381.1.37143 ENSPTRP00000017533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]