SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017653 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017653
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-21
Family SH2 domain 0.00056
Further Details:      
 
Domain Number 2 Region: 266-448
Classification Level Classification E-value
Superfamily Ras GEF 2.09e-16
Family Ras GEF 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017653   Gene: ENSPTRG00000010377   Transcript: ENSPTRT00000019070
Sequence length 576
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:6789603:6805428:-1 gene:ENSPTRG00000010377 transcript:ENSPTRT00000019070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVPQDGEDLAGQPWYHGLLSRQKAEALLQQDGDFLVRASGSRGGNPVISCCWRGSALHF
EVFRVALRPRPGRPTALFQLEDEQFPSIPALVHSYMTGRRPLSQATGAVVSRPVTWQGPL
RRSFSEDTLMDGPARIEPLRARKWSNSQPADLAHMGRSREDPPGMEASTMPISALPRTSS
DPVLLKAPAPLGTVADSLRASDGQLQAKAPTKPPRTPSFELPDASERPPTYCELVPRVPS
VQGTSPSQSCPEPEAPWWEAEEDEEEENRCFTRPQAEISFCPHDAPSCLLGPQNRPLEPQ
VLHTLRGLFLEHHPGSTALHLLLVDCQATGLLGVTRDQRGNMGVSSGLELLTLPHGHHLR
LELLERHQTLALAGALAVLGCSGPLEERAAALRGLVELALALRPGAAGDLPGLAAVMGAL
LMPQVSRLEHTWRQLRRSHTEAALAFEQELKPLMRALDEGAGPCDPGEVALPHVAPMVRL
LEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFV
RRLLWGSRGAGAPRAERFEKFQRVLGVLSQRLEPDR
Download sequence
Identical sequences H2QF57
XP_524075.2.37143 ENSPTRP00000017653 ENSPTRP00000017653 9598.ENSPTRP00000017653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]