SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017783 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017783
Domain Number 1 Region: 30-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.82e-33
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017783   Gene: ENSPTRG00000010454   Transcript: ENSPTRT00000019214
Sequence length 1627
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:10151456:10203811:-1 gene:ENSPTRG00000010454 transcript:ENSPTRT00000019214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRRGLGQPRAGLCLLLAALQLLPGTQADPVDVLKALGVRGGQAGVPEGPGFCPQRTPE
GDRAFRIGQASTLGIPTWELFPEGHFPENFSLLITLRGQPANQSVLLSIYDERGARQLGL
ALGPALGLLGDPFRPLPQQVNLTDGRWHRVAVSIDGEMVTLVTDCEAQPPVLGHGPRFIS
IAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPE
TPRPRRKGKGKGRKKGRGRKGKGRKKNKEILTSSPPPDSPENQTSTDIPKTETPAPNLPP
TPTPLVVTSTVTTGLNATILEGSLDPDSGTELGTLETKAAREDEEGDDSTMGPDFRAAEY
PSRTQFQIFPGAGEKGAKGEPAVIEKGQQFEGPPGAPGPQGVVGPSGPPGPPGFPGDPGP
PGPAGLPGIPGIDGIRGPPGTVIMMPFQFAGGSFKGPPPVSFQQAQAQAVQQTQLSMKGP
PGPVGLTGRPGPVGLPGHPGLKGEEGAEGPQGPRGLQGPHGPPGLVGKMGRPGADGARGL
PGDTGPKGDRGFDGLPGLPGEKGQRGDFGHVGQPGPPGEDGERGAEGPPGPTGQAGEPGP
RGLLGPRGSPGPTGRPGVTGIDGAPGAKGNVGPPGEPGPPGQQGNHGSQGIPGPQGLIGT
PGEKGPPGNPGIPGLPGSDGPPGHPGHEGPTGEKGAQGPPGSAGPPGYPGPRGVKGTSGN
RGLQGEKGEKGEDGFPGFKGDVGLKGDQGKPGAPGPRGEDGPEGPKGQAGQAGEEGPPGS
AGEKGKLGVPGLPGYPGRPGPKGSIGFPGPLGPTGEKGKSGKAGQPGLEGERGPPGSRGE
RGQPGATGQPGPKGDVGQDGAPGIPGEKGLPGLQGPPGFPGPKGPPGHQGKDGRPGHPGQ
RGELGSPGERGPLGPAGGIGLPGQSGSQGPVGTAGEKGSPGERGPPGPTGKDGIPGPLGP
LGPPGAAGPSGEEGDKGDVGAPGHKGSKGDKGDVGPPGQPGIRGPAGHPGPPGADGAQGR
RGPPGLFGQKGDDGVRGFVGVIGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPQGP
SGSEGTPGLPGGVGQPGAVGEKGEPGDAGDPGPPGAPGIPGPKGDIGEKGDSGPSGAAGP
PGKKGPPGEDGAKGSVGPTGLPGDLGPPGDPGVSGIDGSPGEKGDPGDVGGPNPGPSGHM
GREGREGEKGAKGEPGPDGPPGRTGPMGARGPPGRVGPEGLRGIPGPVGEPGLLGAPPQM
GPPGPLGPSGLPGLKGDPGPKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGPKGDP
GPPGPIGSLGHPGPPGVAGPLGQKGSKGSPGSMGPRGDTGPAGPPGPPGPPAELHGLRRR
RRFVPVPLPVVEGGLEEVLASLTSLSLELEQLRRPPGTAERPGLVCHELHRNHPHLPDGE
YWIDPNQGCARDSFRVFCNFTAGGETCLYPDKKFEIVKLASWSKEKPGGWYSTFRRGKKF
SYVDADGSPVNVVQLNFLKLLSATARQNFTYSCQNAAAWLDEATGDYSHSARFLGTNGEE
LSFNQTTAATVSVPQDGCRLRKGQTKTLFEFSSSRAGFLPLWDVAATDFGQTNQKFGFEL
GPVCFSS
Download sequence
Identical sequences ENSPTRP00000017783 ENSPTRP00000017783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]