SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017827 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017827
Domain Number 1 Region: 28-109
Classification Level Classification E-value
Superfamily Immunoglobulin 6.46e-28
Family I set domains 0.0000164
Further Details:      
 
Domain Number 2 Region: 213-309
Classification Level Classification E-value
Superfamily Immunoglobulin 1.65e-23
Family I set domains 0.00000551
Further Details:      
 
Domain Number 3 Region: 109-203
Classification Level Classification E-value
Superfamily Immunoglobulin 2.39e-22
Family C2 set domains 0.00000237
Further Details:      
 
Domain Number 4 Region: 392-479
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000425
Family I set domains 0.0000163
Further Details:      
 
Domain Number 5 Region: 310-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000208
Family C2 set domains 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017827   Gene: ENSPTRG00000010463   Transcript: ENSPTRT00000019261
Sequence length 532
Comment pep:known chromosome:CHIMP2.1.4:19:10459559:10475064:1 gene:ENSPTRG00000010463 transcript:ENSPTRT00000019261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPPKVILPRGGSVQVTCSTSCDQPDLLGI
ETPLPKKELLLGGNNWKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKDLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVERDHH
GANFSCRTELDLRPQGLQLFENTSAPHQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVLEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSRE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPVGPRVQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
ASGNPLPELKCLKDGTFPLPVGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIRKYRLQQAQKGTPMKPNTQATPP
Download sequence
Identical sequences K7A128 Q28806
9598.ENSPTRP00000017827 ENSPTRP00000017827 NP_001009946.1.37143 ENSPTRP00000017827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]