SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017989 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017989
Domain Number 1 Region: 168-457
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.19e-41
Family WD40-repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 70-137
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000445
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017989   Gene: ENSPTRG00000010534   Transcript: ENSPTRT00000019434
Sequence length 459
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:12954908:12965447:-1 gene:ENSPTRG00000010534 transcript:ENSPTRT00000019434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPLGRCDDSRTWDNDESDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAAS
PSASEPRAASKVSAVSEPGLLSLPPELLLEICSYLDARLVLHVLSRVCHALRDLVSDHVT
WRLRALRRVRAPYPVVEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSV
LLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLVKTLGTKRNSTHEGWVWSLAAQDHRV
CSGSWDSTVKLWDMAADGQQFGEIKASSAVLCLSYLPDILVTGTYDKKVTIYDPRAGPAL
LKHQQLHSRPVLTLLADDRHIISGSEDHTLVVVDRRANSVLQRLQLDSYLLCMSYQEPQL
WAGDNQGLLHVFANRNGCFQLIRSFDVGHSFPITGIQYSVGALYTTSTDKTIRVHVPTDP
PRTICTRRHDNGLNRVCAEGNLVVAGSGDLSLEVWRLQA
Download sequence
Identical sequences ENSPTRP00000017989 ENSPTRP00000017989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]