SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018011 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018011
Domain Number 1 Region: 215-280
Classification Level Classification E-value
Superfamily XPC-binding domain 1.24e-21
Family XPC-binding domain 0.0000365
Further Details:      
 
Domain Number 2 Region: 10-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000747
Family Ubiquitin-related 0.0001
Further Details:      
 
Domain Number 3 Region: 290-348
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000126
Family UBA domain 0.00035
Further Details:      
 
Domain Number 4 Region: 139-190
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000211
Family UBA domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018011   Gene: ENSPTRG00000010552   Transcript: ENSPTRT00000019458
Sequence length 350
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:13220008:13228279:1 gene:ENSPTRG00000010552 transcript:ENSPTRT00000019458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTITLKTLQVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVV
VMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTS
PESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHR
AVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPA
LLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNY
IQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
Download sequence
Identical sequences ENSPTRP00000018011 9598.ENSPTRP00000018011 ENSPTRP00000018011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]