SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018245 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018245
Domain Number 1 Region: 613-718
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-32
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 323-427
Classification Level Classification E-value
Superfamily SH2 domain 1.27e-29
Family SH2 domain 0.00000218
Further Details:      
 
Domain Number 3 Region: 113-261
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-16
Family BCR-homology GTPase activation domain (BH-domain) 0.00033
Further Details:      
 
Domain Number 4 Region: 5-82
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000374
Family SH3-domain 0.0000952
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018245   Gene: ENSPTRG00000010694   Transcript: ENSPTRT00000019722
Sequence length 728
Comment pep:known chromosome:CHIMP2.1.4:19:18446047:18460972:1 gene:ENSPTRG00000010694 transcript:ENSPTRT00000019722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLA
LPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPALG
PAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPP
ALPPKPPKAKPAPTVLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTR
LLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRT
KLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNE
TEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVV
VDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPG
PGPPPAAR
Download sequence
Identical sequences H2QFS6
9598.ENSPTRP00000018245 HR5531 NP_005018.1.87134 NP_005018.1.92137 XP_512509.2.37143 ENSPTRP00000018245 ENSPTRP00000018245 gi|4826908|ref|NP_005018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]