SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018263 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018263
Domain Number 1 Region: 6-198
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 2.35e-60
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018263   Gene: ENSPTRG00000010703   Transcript: ENSPTRT00000019740
Sequence length 209
Comment pep:known chromosome:CHIMP2.1.4:19:18637035:18660988:1 gene:ENSPTRG00000010703 transcript:ENSPTRT00000019740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPA
LWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSII
DMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQ
LGRALRAIIEEMLDLLEQSEGKINYCHKH
Download sequence
Identical sequences A0A2I3HNV5 G3RNX9 H2NY33 H2QFT0 Q9NXJ5
ENSP00000269919 ENSNLEP00000007280 gi|8923198|ref|NP_060182.1| ENSP00000269919 ENSPPYP00000010910 ENSPTRP00000018263 ENSNLEP00000007280 ENSPTRP00000018263 NP_060182.1.87134 NP_060182.1.92137 XP_001162684.1.37143 XP_002828971.1.23681 XP_003275873.1.23891 XP_003817823.1.60992 XP_018872048.1.27298 ENSP00000252813 9598.ENSPTRP00000018263 9600.ENSPPYP00000010910 9606.ENSP00000252813 ENSPPYP00000010910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]