SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018267 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018267
Domain Number 1 Region: 43-110
Classification Level Classification E-value
Superfamily L domain-like 0.000000156
Family Ngr ectodomain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018267   Gene: ENSPTRG00000010708   Transcript: ENSPTRT00000019745
Sequence length 305
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:18689452:18695929:-1 gene:ENSPTRG00000010708 transcript:ENSPTRT00000019745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGTLAWTLLLPLLLPESDSLELSCTVSSADVDWNAEFRATCLNFSGLSLSLPHNQSLRA
SNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCAL
ESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATIGAVVVSGCLLLGLA
IAGPVLAWRLWRCRVARSRELNKPWAAQDGPKPSLGLQPRYGSRSAPKPQVAVPSCPSTP
DYENMFVGQPAAEHQWDEQGAHPSEDNDFYMNYKDIDLASQPVYCNLQSLGQAPMDEEEY
VIPGH
Download sequence
Identical sequences H2QFT2
ENSPTRP00000018267 XP_001173930.1.37143 XP_003817822.1.60992 XP_008969281.1.60992 XP_009433303.1.37143 9598.ENSPTRP00000018267 ENSPTRP00000018267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]