SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018311 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018311
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.82e-23
Family APC10-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018311   Gene: ENSPTRG00000010733   Transcript: ENSPTRT00000019797
Sequence length 167
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:19517931:19519883:-1 gene:ENSPTRG00000010733 transcript:ENSPTRT00000019797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVS
QLQIQFQGGFSSRRGCLEGSQGTQALRKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDA
TDFFGRVIIYHLRVLGEKGTNRDPCRDLHYRAKLGEPRPHPRNLNFP
Download sequence
Identical sequences H2QFU9
ENSPTRP00000018311 XP_003817786.1.60992 XP_009433347.1.37143 ENSPTRP00000018311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]