SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018540 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018540
Domain Number 1 Region: 51-190
Classification Level Classification E-value
Superfamily L domain-like 4.81e-34
Family Ngr ectodomain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018540   Gene: ENSPTRG00000010830   Transcript: ENSPTRT00000020050
Sequence length 537
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:40325355:40335160:-1 gene:ENSPTRG00000010830 transcript:ENSPTRT00000020050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAGILLLLLAGAGVVVAWRPPKGKCPPRCSCSKDSALCEGSPDLPVSFSPTLLSLSLV
RTGVTQLKAGSFLRIPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEIGSISKNAL
RGLRSLTHLSLANNHLETLPRFLFRGLDTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASV
GTGACAGPASLSHMQLHHLDPKTFKCRAIELSWFQTVGESALSVEPFSYQGEPHIVLAQP
FAGRCLILSWDYSLQRFRPEEELPAASVVSCKPLVLGPSLFVLAARLWGGSQLWARPSPG
LRLAPTQTLAPRRLLRPNDAELLWLEGQPCSIEADASRAGRTMLLYRGEPGFCPYQSSHA
CHWDTDAEALELDGRPHLQLASASQRPVLFHWTGGRFERRTDIPEAEDVYATRHFQAGGD
VFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLR
LEPDKGLLEPLQELGPPALVAPRAFAHITMASRRFLFAACFKGPTQIYQHHEIDLSA
Download sequence
Identical sequences ENSPTRP00000018540 ENSPTRP00000018540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]