SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018633 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018633
Domain Number 1 Region: 41-299
Classification Level Classification E-value
Superfamily L domain-like 1.51e-44
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 294-389
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 424-502
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000574
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018633   Gene: ENSPTRG00000010877   Transcript: ENSPTRT00000020148
Sequence length 628
Comment pep:known chromosome:CHIMP2.1.4:19:41139982:41148316:1 gene:ENSPTRG00000010877 transcript:ENSPTRT00000020148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILPLLLCLLPLAPASSPPQSATPSPCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRR
AAELRLADNFIASVRRRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLT
SLGEGQLRGLVNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLG
NVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPAS
ALVLAFGGNPLHCNCELVWLRRLAREDDLEACASPPALGGRYFWAVGEEEFVCEPPVVTH
RSPPLAVPAGRPAALRCRAVGDPEPRVRWVSPQGRLLGNSSRARAFPNGTLELLVTEPGD
GGIFTCIAANAAGEATAAVELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAASASAKV
ADTGPPTDRGVQVTEHGATAALVQWPDQRPIPGIRVYQIQYNSSADDILVYRMIPAESRS
FLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFSTEPALRPCGAPHAPFLGGTMI
IALGGVIVASVLVFIFVLLMRYKVHGGQPPGKAKIPAPVSSVCSQTNGALGPTPTPAPPA
PEPAALRAHTVVQLDCEPWVPGHEPVGP
Download sequence
Identical sequences H2QG51
XP_524229.1.37143 ENSPTRP00000018633 9598.ENSPTRP00000018633 ENSPTRP00000018633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]