SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018766 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018766
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-30
Family F-box associated region, FBA 0.0006
Further Details:      
 
Domain Number 2 Region: 181-305
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000000000000113
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00042
Further Details:      
 
Domain Number 3 Region: 305-377
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00000000000663
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0013
Further Details:      
 
Domain Number 4 Region: 86-179
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0000000126
Family Seryl-tRNA synthetase (SerRS) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018766   Gene: ENSPTRG00000010947   Transcript: ENSPTRT00000020289
Sequence length 405
Comment pep:novel chromosome:CHIMP2.1.4:19:44137551:44163884:-1 gene:ENSPTRG00000010947 transcript:ENSPTRT00000020289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVWQELLDSAQIEICVADWWGARENCGCVYQLRVRLLDVYEKEVVKFSASPDPVLQWT
ERGCRQVSHVFTNFGKGIRYVSFEQYGRDISTWQELRQLQEQIRSLEEEKAAVTEAVRAL
LANQDSGEVQQDPKYQGLRARGREIRKELVHLYPREAQLEEQFYLQALKLPNQTHPDVPV
GDESQARVLHVVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQH
GLVNFTFNKLLRRGFTPMMVPDLLRGAVFEGCGMTPNANPSQIYNIDPARFKDLNLAGTA
EVGLAVLDMPTQELGLPAYRKFDIEAWMPCRGRFGEVNATACAVPRLLIALLESNQQKDG
SVLVPPALQSYLGTDRITAPTHVPLRYIGPNQPRKPGLPGQPAVS
Download sequence
Identical sequences ENSPTRP00000018766 ENSPTRP00000018766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]