SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018774 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018774
Domain Number 1 Region: 101-210
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.89e-38
Family F-box associated region, FBA 0.00042
Further Details:      
 
Domain Number 2 Region: 15-78
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000222
Family F-box domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018774   Gene: ENSPTRG00000010950   Transcript: ENSPTRT00000020297
Sequence length 213
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:44244724:44251649:-1 gene:ENSPTRG00000010950 transcript:ENSPTRT00000020297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVVSHVPPRTLLGRCRQVCRGWRAL
VDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCG
QWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRF
VSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS
Download sequence
Identical sequences ENSPTRP00000018774 9598.ENSPTRP00000018774 ENSPTRP00000018774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]