SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018779 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018779
Domain Number 1 Region: 92-272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-52
Family F-box associated region, FBA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018779   Gene: ENSPTRG00000010953   Transcript: ENSPTRT00000020303
Sequence length 275
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:44423615:44428573:1 gene:ENSPTRG00000010953 transcript:ENSPTRT00000020303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVREGHALGGGMEADGPASPQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPE
PAQPSEAHARQLLLEEWGPLSGGLELPQRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPA
PPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPAITV
MDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPG
VRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE
Download sequence
Identical sequences H2QG99
9598.ENSPTRP00000018779 ENSPTRP00000018779 XP_524260.2.37143 ENSPTRP00000018779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]