SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018821 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018821
Domain Number 1 Region: 36-165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-39
Family Galectin (animal S-lectin) 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018821   Gene: ENSPTRG00000010979   Transcript: ENSPTRT00000020345
Sequence length 168
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:44836422:44839984:-1 gene:ENSPTRG00000010979 transcript:ENSPTRT00000020345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTRKLHLCKYWGCALSSVCPFLEGRPWPLMIVVPYKLPVSLSVGSCVIIKGTPIDSFI
NDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETADYVPFEDGKQFEL
CIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Download sequence
Identical sequences ENSPTRP00000018821 ENSPTRP00000018821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]