SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018996 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018996
Domain Number 1 Region: 36-141
Classification Level Classification E-value
Superfamily Immunoglobulin 3.73e-25
Family V set domains (antibody variable domain-like) 0.00057
Further Details:      
 
Domain Number 2 Region: 144-233
Classification Level Classification E-value
Superfamily Immunoglobulin 5.83e-17
Family I set domains 0.0054
Further Details:      
 
Domain Number 3 Region: 237-318
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-16
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018996   Gene: ENSPTRG00000011063   Transcript: ENSPTRT00000020555
Sequence length 344
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:46825306:46836057:1 gene:ENSPTRG00000011063 transcript:ENSPTRT00000020555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQ
NRIGYSWYKGERVDGNRLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWV
NGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVP
TISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ
AHNSATGLNRTTVTMITVSGSAPVLSAVATVGIMIGVLARVALI
Download sequence
Identical sequences A0A2I3TN57
ENSPTRP00000018996 ENSPTRP00000018996 XP_003316416.1.37143 9598.ENSPTRP00000018944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]