SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019037 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019037
Domain Number 1 Region: 15-157
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-53
Family N-terminal domain of xrcc1 0.000000286
Further Details:      
 
Domain Number 2 Region: 545-635
Classification Level Classification E-value
Superfamily BRCT domain 1.96e-22
Family DNA-repair protein XRCC1 0.00000643
Further Details:      
 
Domain Number 3 Region: 323-409
Classification Level Classification E-value
Superfamily BRCT domain 3.01e-21
Family BRCT domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019037   Gene: ENSPTRG00000011084   Transcript: ENSPTRT00000020607
Sequence length 639
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:48709097:48742796:-1 gene:ENSPTRG00000011084 transcript:ENSPTRT00000020607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STSSFWPGEAHDVDMPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVV
LQLEKEEQIHSVDGNDGSAFVVLGSASAGTDVLLVTSSFMSPSESRSGSNPNRVRMFGPD
KLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFR
VKEEDESASSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGS
TSKPQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGA
VTGKPRGEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWT
RDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRSYLMAGPGSSSEEDE
ASHSGGSGDEAPKLPQKRPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQ
SEGQDNGAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDL
PVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSF
EEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Download sequence
Identical sequences ENSPTRP00000019037 ENSPTRP00000019037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]