SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019041 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000019041
Domain Number - Region: 161-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00031
Family Classic zinc finger, C2H2 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019041   Gene: ENSPTRG00000011089   Transcript: ENSPTRT00000020613
Sequence length 191
Comment pep:known chromosome:CHIMP2.1.4:19:48775354:48787930:-1 gene:ENSPTRG00000011089 transcript:ENSPTRT00000020613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETREPAETGGYASLEEDDEDLSPGPEHSSDSEYTLSEPDSEEEEDEEEEEEETTDDPE
YDPGYKVKQRLGGGRGGPSRRAPRAAQPPGPPAQPCQLCGRSPLGEAPPGTPPCRLCCPA
TAPQEAPAPEGRALGEEEEEPPRAGEGRPAGREEEEEEEEEGTYHCTECEDSFDNLGELH
GHFMLHARGEV
Download sequence
Identical sequences A0A0A0MVK9 A0A0D9S1C5 A0A2I2Z0M2 A0A2I3TIJ9 A0A2K5KVV8 A0A2K5WHQ6 A0A2K5YF15 A0A2K6DMM1 F6Q7R5
ENSPTRP00000019041 NP_001257698.1.72884 XP_001157292.1.37143 XP_003817632.1.60992 XP_004060925.1.27298 XP_005589512.1.63531 XP_005589513.1.63531 XP_007995238.1.81039 XP_007995239.1.81039 XP_011709547.1.29376 XP_011853090.1.47321 XP_011853091.1.47321 XP_011886154.1.92194 ENSMMUP00000006132 ENSPTRP00000019041 ENSMMUP00000006132 9544.ENSMMUP00000006132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]