SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019088 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019088
Domain Number 1 Region: 116-202
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-47
Family SH2 domain 0.0000142
Further Details:      
 
Domain Number 2 Region: 208-286
Classification Level Classification E-value
Superfamily RING/U-box 8.73e-41
Family RING finger domain, C3HC4 0.00012
Further Details:      
 
Domain Number 3 Region: 12-82
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.00000000000000327
Family N-terminal domain of cbl (N-cbl) 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000019088
Domain Number - Region: 83-115
Classification Level Classification E-value
Superfamily EF-hand 0.0112
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019088   Gene: ENSPTRG00000011123   Transcript: ENSPTRT00000020670
Sequence length 356
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:49960963:49987061:1 gene:ENSPTRG00000011123 transcript:ENSPTRT00000020670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAVAPWGRQREEARALGRAVRMLQRRECDPLVSPSLRLLPTQLLREGAHSRRQLAKLA
IIFSHMHAELHALFPGGKYCGHMYQLTKAPAHTFWRESCGAPWPTLLKNWQLLAVNHPGY
MAFLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPVNKPLSQVL
LEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFELCKICAESN
KDVKIEPCGHLLCSRCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSD
QEGRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
Download sequence
Identical sequences ENSPTRP00000019088 ENSPTRP00000019088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]