SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019094 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000019094
Domain Number - Region: 14-190
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00262
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019094   Gene: ENSPTRG00000011126   Transcript: ENSPTRT00000020678
Sequence length 295
Comment pep:novel chromosome:CHIMP2.1.4:19:50082471:50092977:1 gene:ENSPTRG00000011126 transcript:ENSPTRT00000020678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRGSERTPGA
ATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVA
LSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQT
QQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGLQVGVEFEASTRMQDTSVSFGYQLD
LPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Download sequence
Identical sequences ENSPTRP00000019094 ENSPTRP00000019094 9598.ENSPTRP00000019094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]