SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019296 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019296
Domain Number 1 Region: 345-472
Classification Level Classification E-value
Superfamily TIMP-like 7.06e-29
Family Tissue inhibitor of metalloproteinases, TIMP 0.021
Further Details:      
 
Domain Number 2 Region: 212-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000259
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 3 Region: 157-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family EGF-type module 0.07
Further Details:      
 
Domain Number 4 Region: 275-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019296   Gene: ENSPTRG00000011250   Transcript: ENSPTRT00000020902
Sequence length 489
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:53643404:53654894:-1 gene:ENSPTRG00000011250 transcript:ENSPTRT00000020902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTFALLLLLGQATADPCYDPQGRPQFCLPPVTQLAAVAASCPQACALSPGNHLGARET
CNGSLTLALGGPFLLTSVSLRFCTPGPPALILSAAWASGGPWRLLWHRPAWPGALGGPER
VTFHSTPGPKATVAASHLRVEFGGQAGLAAAGLRGRCQCHGHAARCAARARPPRCHCRHH
TTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCE
RCRHHTAGRHCHYCQPGFWRDPSQPISSRRACKACQCHPIGATGGTCNQTSGQCTCKLGV
TGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSL
RRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPVRRGDQDAWVPRADLACGC
LRLQPGTDYLLLGSAVGDPDPTRLILDRHGLALPWRPRWARPLKRLQQEDRAGGCRGVRA
PTPSPRPEH
Download sequence
Identical sequences ENSPTRP00000019296 9598.ENSPTRP00000019296 ENSPTRP00000019296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]