SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019303 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019303
Domain Number 1 Region: 169-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000987
Family I set domains 0.047
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000019303
Domain Number - Region: 114-173
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0233
Family AN1-like Zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019303   Gene: ENSPTRG00000011255   Transcript: ENSPTRT00000020910
Sequence length 350
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:53725433:53731459:-1 gene:ENSPTRG00000011255 transcript:ENSPTRT00000020910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPHFTLLCAALAGCLLPAEGCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENA
VKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKE
TFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMIL
DCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNS
SPATIINFHVTVLPRMIKEEKPSPNIVTPGEATTESSITLQPLKPEKMLASRLLGLLICG
SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ
Download sequence
Identical sequences H2QGS4
XP_016791943.1.37143 XP_016791944.1.37143 9598.ENSPTRP00000019303 ENSPTRP00000019303 ENSPTRP00000019303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]