SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019500 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019500
Domain Number 1 Region: 179-322
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-24
Family C-type lectin domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019500   Gene: ENSPTRG00000011350   Transcript: ENSPTRT00000021119
Sequence length 323
Comment pep:known chromosome:CHIMP2.1.4:19:55648333:55650701:1 gene:ENSPTRG00000011350 transcript:ENSPTRT00000021119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAG
RGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSSPSPSPTPEDIVTYILGRLAGLDA
GLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKG
LRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWL
GVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQA
SDDGSWWDHDCQRRLYYVCEFPF
Download sequence
Identical sequences H2QGY4
ENSPTRP00000019500 ENSPTRP00000019500 XP_001173878.1.37143 9598.ENSPTRP00000019500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]