SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019545 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019545
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily Immunoglobulin 5.24e-21
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 
Domain Number 2 Region: 115-201
Classification Level Classification E-value
Superfamily Immunoglobulin 9.26e-19
Family I set domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019545   Gene: ENSPTRG00000011374   Transcript: ENSPTRT00000021166
Sequence length 274
Comment pep:novel chromosome:CHIMP2.1.4:19:56084712:56090288:1 gene:ENSPTRG00000011374 transcript:ENSPTRT00000021166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPESVTVQEGLCIFVHCSVFYLEYGWKDSTPAYGYWFREGVSVDQETPVATNNSKVQETQ
GRFHLLGDPSRNNCSLSIRDAKRRDNGSYFFRVARGRTKFSYKYSPLSVYVTALTHRPDI
LIPEFLKSGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTLHSSVLTIIPWPQDHG
TNLTCQVTFPGAGVTTERTIQLSVSYPLMNPVIEASLEDGTGKSGTVEEVVVLAVGVVAV
KILLLCLCLIILSFHKKKAVRAVEVEENVYAVMG
Download sequence
Identical sequences ENSPTRP00000019545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]