SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019556 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019556
Domain Number 1 Region: 28-136
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-20
Family V set domains (antibody variable domain-like) 0.0000389
Further Details:      
 
Domain Number 2 Region: 154-240
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-17
Family I set domains 0.044
Further Details:      
 
Domain Number 3 Region: 270-346
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000167
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019556   Gene: ENSPTRG00000011384   Transcript: ENSPTRT00000021182
Sequence length 499
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:56346044:56352806:-1 gene:ENSPTRG00000011384 transcript:ENSPTRT00000021182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLLPLLWGTKGMEGDRQYGDGYLLQVQELVTVQEGLCVHVPCFFSYPQDGWTDSD
PVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKG
SYFFRLERGSMKWSYKSQLNYKAKQLSVFVTALTHRPDILIRGTLESGHPRNLTCSVPWA
CKQGTPPMISWIGASVSSPGPTTARSSVLTLIPKPQDHGTSLACQVTLPGTGVTTTSTVR
LNVSYPPWNLTMTVFQGDATASTALGNGSSLSVLEGQSLRLICAVNSNPPARLSWTRGSL
TLCPSRSSNPGLLELPPVHVRDEGEFTCRAQNPQGSQHISLSLSLQNEGTGTSRPVSQVT
LAAVGGAGATALAFLSFCIIFIIVRSCGKKSARPAAGVGDTGMEDAKAIRGSASQGPLTE
SWKDGNPPKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRET
AETQACLRNHNPSSKEVRG
Download sequence
Identical sequences A0A2J8Q6T8
ENSPTRP00000019556 ENSPTRP00000019556 9598.ENSPTRP00000019556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]