SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019798 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019798
Domain Number 1 Region: 188-292
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 293-398
Classification Level Classification E-value
Superfamily SRCR-like 5.49e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 759-867
Classification Level Classification E-value
Superfamily SRCR-like 9.02e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000975
Further Details:      
 
Domain Number 4 Region: 10-114
Classification Level Classification E-value
Superfamily SRCR-like 1.29e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 5 Region: 455-561
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019798   Gene: ENSPTRG00000023746   Transcript: ENSPTRT00000021454
Sequence length 973
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:60410905:60436891:1 gene:ENSPTRG00000023746 transcript:ENSPTRT00000021454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLACLLERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRQLGCGGALAA
PGGAFFGEGAGPVWLSELACRGNEGQLGLCHHRGWKAHICSHEEDAGVVCAGQRVANSRD
DSTSPLDGAPWPGLLLELSPSTEEPLVTHAPRPAGNPQNASRKKSPRPKQAKSTRAPLLT
TGAPRQERLRLVSGPHRCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRELGCGGALAAPG
GARFGPGAGPVWMDDVGCGGGEQALRDCPRSPWGRSNCDHSEDAGLVCTGPAPRLRLADG
PHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRELGCGGALAAPGGAFFGEGSGPIILD
DLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGYVPPTAPTDSNNSTPREAAS
RPPSTMTSQAPGTAGVSPPPASPTVLWEPGPEAGSPQLRLVAGPSKCSGRLEVWHDQRWG
TVCDDSWDMRDSAVVCRELGCGGPRQPDPAAGRFGWGAGPIWLDDVGCVGTEASLSDCPA
APWGKHNCAHNEDVGVTCTEPPGLDSISDPFSWSWIPGLGRDRDAWLPGELATKPSASVT
ASVLEKTTTKAPGKMPKSTKKWVTKNAKRPTTQPPVMPTTKHSRAQSPPDLTSQTTTALT
TEASRRRTSEFTRRPTVEAPQRWTSHTTATLTPQAPRERTTKTMAMLTTQGPQEMTSEST
IKSIPQASLEPSAEIPEGSPESPKDPAPSPSVSTTGESGLFRVRLADGPNRCAGRLEVWH
AGRWGTVCDDNWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMGCKGSEASLS
DCPSGAWGKHNCDHEEDVGLTCTGYTDYDDYPPWTWDPTSTEDLAKGTTTAGVPGHTLPW
RTTRRPGSSSPATRRLPDTGSKDGYKLPWTWDTPSGGGLAEGTPTAGKLGPTLGAGTTRS
PGSPPTPRVHGDT
Download sequence
Identical sequences ENSPTRP00000019798 ENSPTRP00000019798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]