SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019822 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019822
Domain Number 1 Region: 88-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-61
Family SPRY domain 0.0000000112
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000919
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019822   Gene: ENSPTRG00000038808   Transcript: ENSPTRT00000021480
Sequence length 287
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:60781658:60789780:1 gene:ENSPTRG00000038808 transcript:ENSPTRT00000021480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHFKQVIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDD
IKPKYKLRALVSIIKELEPKLKKVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRS
GDLSHNRKEQPERFDTALCVLGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVL
SSEHGFLTVGCREGKVFAASTVPMTPLWVSPQLHRVGIFLDVGMRSIAFYNVSDGCHIYT
FIEIPVCEPWRPFFAHQRGSQDDQSILSICSVINPASASAPVSSGGK
Download sequence
Identical sequences ENSPTRP00000019822 ENSPTRP00000019822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]