SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019970 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019970
Domain Number 1 Region: 495-1074
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 5.06e-203
Family Myeloperoxidase-like 0.000000000539
Further Details:      
 
Domain Number 2 Region: 102-196
Classification Level Classification E-value
Superfamily Immunoglobulin 2.04e-26
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 186-281
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-25
Family I set domains 0.0077
Further Details:      
 
Domain Number 4 Region: 287-375
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-24
Family I set domains 0.036
Further Details:      
 
Domain Number 5 Region: 5-99
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 1174-1232
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000136
Family VWC domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019970   Gene: ENSPTRG00000011612   Transcript: ENSPTRT00000021645
Sequence length 1239
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:1558392:1602560:-1 gene:ENSPTRG00000011612 transcript:ENSPTRT00000021645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTERPRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDDG
TLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQNTEVLVGESVT
LECSATGHPPPRISWTRGDRTPLPVDPRVNITPSGGLYIQNVVQEDSGEYACSATNNIDS
VHATAFIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHL
VLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVEVGA
NVQLPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTI
GSASVSMVLSVNVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLAL
FRYPRDPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYHYNDLVSPQYLNLIANL
SGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRG
INPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQAR
FSDGQHCSSVCSNDPPCFSVMIPPNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPR
EQINQLTSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECM
RDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRK
IVGAEIQHITYQHWLPKILGEVGMRTLGEYHGYDPGINAGIFNAFATAAFRFGHTLVNPL
LYRLDENFQPIAQDHLPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVPSQLLNTELT
ERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKNEIKNPEIREK
LKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPA
QLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCEDCR
TRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVGRQGEHLSNSTSAFSTRSDAP
GTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECK
DGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEKP
Download sequence
Identical sequences ENSPTRP00000019970 ENSPTRP00000019970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]