SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019981 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019981
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.15e-56
Family Allantoicase repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 188-369
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-49
Family Allantoicase repeat 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019981   Gene: ENSPTRG00000011618   Transcript: ENSPTRT00000021656
Sequence length 391
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:3170798:3221006:1 gene:ENSPTRG00000011618 transcript:ENSPTRT00000021656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHD
WCVLRLGIQGVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGIRTGAAATPEE
FEAIAELKSDDWSYLVPMTALKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVF
GTGQKDWTATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRL
DRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQ
EEEAVIKQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSR
LRLWGFPSSICLLRPREKPMMKFSVGFKANP
Download sequence
Identical sequences H2QHD7
ENSPTRP00000019981 XP_525676.3.37143 ENSPTRP00000019981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]