SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020199 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000020199
Domain Number - Region: 121-209
Classification Level Classification E-value
Superfamily RNI-like 0.00018
Family Cyclin A/CDK2-associated p19, Skp2 0.07
Further Details:      
 
Domain Number - Region: 215-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020199   Gene: ENSPTRG00000011755   Transcript: ENSPTRT00000021896
Sequence length 284
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:27590921:27596077:1 gene:ENSPTRG00000011755 transcript:ENSPTRT00000021896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSAELHEQEKPPSSPRPTGPGRLGHARGRGPDALRGGAAGPGRASSGAPRERKMAPHG
PGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVALYCKTTRELMLHARCC
LNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILP
QDVSCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCAD
GFHGYKCMRQGSFSLLMFFGILGSTTLSVSILLWATQRRKAKTS
Download sequence
Identical sequences H2QHL9
ENSPTRP00000020199 XP_001154610.1.37143 9598.ENSPTRP00000020199 ENSPTRP00000020199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]