SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020259 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020259
Domain Number 1 Region: 1085-1364
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-66
Family Protein kinases, catalytic subunit 0.000000804
Further Details:      
 
Domain Number 2 Region: 472-629
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000174
Family MAM domain 0.05
Further Details:      
 
Domain Number 3 Region: 262-425
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000038
Family MAM domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020259   Gene: ENSPTRG00000011796   Transcript: ENSPTRT00000021957
Sequence length 1469
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:29600715:30328482:-1 gene:ENSPTRG00000011796 transcript:ENSPTRT00000021957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEA
RTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ
GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDY
FTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRVPSEEASQ
MDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR
YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF
ALKNCSEASPAKWRGLQTTSTRPGWCIVLVSGVRWGDSGPCGDERGSRKLPVGFYCNFED
GFCGWTQDTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPTSESATVTSATFPAPIK
SSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWTVLPLLDVS
DRFWLRMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNPNKEL
KPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPLKGIQ
IWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACP
STNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGG
GGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGH
SCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGI
LYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVSCIVS
PTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLR
TSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSP
LQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAGGSQ
PTSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDI
YRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSLGGMLWEIFFFGLLPYPSESNQE
VLEFVTSGGRMDPPKNCXGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQAKKEPHERG
NLGLEGSCTVPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGL
PLEAATAPGAGHYEDTILKSKNSMNQPGP
Download sequence
Identical sequences ENSPTRP00000020259 ENSPTRP00000020259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]