SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020306 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020306
Domain Number 1 Region: 359-417
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000241
Family VWC domain 0.011
Further Details:      
 
Domain Number 2 Region: 637-694
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000502
Family VWC domain 0.015
Further Details:      
 
Domain Number 3 Region: 278-351
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000105
Family VWC domain 0.0033
Further Details:      
 
Domain Number 4 Region: 3-69
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.0028
Further Details:      
 
Domain Number 5 Region: 711-768
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000126
Family VWC domain 0.0073
Further Details:      
 
Domain Number 6 Region: 558-624
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000001
Family VWC domain 0.0074
Further Details:      
 
Domain Number 7 Region: 524-552
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000153
Family Huristasin-like 0.0079
Further Details:      
 
Domain Number 8 Region: 493-526
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000419
Family Huristasin-like 0.003
Further Details:      
 
Domain Number 9 Region: 467-494
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000663
Family Huristasin-like 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000020306
Domain Number - Region: 431-458
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0015
Family Huristasin-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020306   Gene: ENSPTRG00000011827   Transcript: ENSPTRT00000022011
Sequence length 774
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:36887117:37052356:1 gene:ENSPTRG00000011827 transcript:ENSPTRT00000022011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKCEEPRNCSGSIVQGVCGCCYTCASQRNESCAGTFGITGTCDRGLRCVIRPPLNGDSLT
EYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLS
ALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLPSRCVCNPAGCLRKVC
QPGNLNILVSKASGKPGECCDLYECKPVFGVDCRTVECPPVQQTACPPDSYETQVRLTAD
GCCTLPTRCECLSGLCGFPVCEVGSTPRIVSRGDGTPGKCCDVFECVNDTKPACVFNNVE
YYDGDMFRMDNCRFCRCQGGVAICFTAQCGEINCERYYVPEGECCPVCEDPVYPFNNPTG
CYANGLILAHGDRWREDDCTFCQCVNGERHCVATVCGQTCTNPVKVPGECCPVCEEPTII
TVDPPACGELSNCTLTGKDCIHGFKRDHNGCRTCQCINTEELCSERKQGCTLNCPFGFLT
DAQNCEICECRPRPKKCRPIICDKYCPLGLLKNKHGCDICRCKKCPELSCSKICPLGFQQ
DSHGCLICKCREASASAGPPILSGTCLTVDGHHHKNEESWHDGCRECYCLNGREMCALIT
CPVPACGNPTIHPGQCCPSCADDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQCT
CHSGRVLCETEVCPPLLCQNPSRTQDSCCPQCTDQPFRPSLSRNNSVPNYCKNDEGDIFL
AAESWKPDVCTSCICIDSVISCFSESCPSVSCERPVLRKGQCCPYCIGKTKEKK
Download sequence
Identical sequences ENSPTRP00000020306 ENSPTRP00000020306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]