SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020468 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020468
Domain Number 1 Region: 865-904,960-1041,1143-1231,1346-1416,1500-1826
Classification Level Classification E-value
Superfamily ARM repeat 4.94e-39
Family HEAT repeat 0.059
Further Details:      
 
Domain Number 2 Region: 89-185,274-727
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000121
Family HspBP1 domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020468   Gene: ENSPTRG00000011920   Transcript: ENSPTRT00000022183
Sequence length 1843
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:54711030:54817695:-1 gene:ENSPTRG00000011920 transcript:ENSPTRT00000022183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAERAGVGEPPEPGGRPEPGPRGFVPQKEIVYNKLLPYAERLDAESDLQLAQIKCNLG
RAVQLQELWPGGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFA
RLLINLLKKKELLSRADLELPWRPLYDMVERILYSKTEHLGLNWFPNSVENILKTLVKSC
RPYFPADATAEMLEEWRPLMCPFDVTMQKAITYFEIFLPTSLPPELHHKGFKLWFDELIG
LWVSVQNLPQWEGQLVNLFARLATDNIGYIDWDPYVPKIFTRILRSLNLPVGSSQVLVPR
FLTNAYDIGHAVIWITAMMGGPSKLVQKHLTGLFNSITSFYHPSNNGRWLNKLMKLLQRL
PNSVVRRLHRERYKKPSWLTPVPDSHKLTDQDVTEFVQCIIQPVLLAMFSKTGSLEAAQA
LQNLALMRPELVIPPVLERTYPALETLTEPHQLTATLSCVIGVARSLVSGGRWFPEGPTH
MLPLLMRALPGVDPNDFSKCMITFQFIATFSTLVPLVDCSSVLQERNDLTEVERELCSAT
AEFEDFVLQFMDRCFGLIESSTLEQTREETETEKMTHLESLVELGLSSTFSTILTQCSKE
IFMVALQKVFNFSTSHIFETRVAGRMVADMCRAAVKCCPEESLKLFVPHCCSVITQLTMN
DDVLNDEELDKELLWNLQLLSEITRVDGRKLLLYREQLVKILQRTLHLTCKQGYTLSCNL
LHHLLRSTTLIYPTEYCSVPGGFDKPPSEYFPIKDWGKPGDLWNLGIQWHVPSSEEVSFA
FYVLDSFLQPELVKLQHCGDGKLEMSRDDILQSLTIVHNCLIGSGNLLPPLKGEPVTNLV
PSMVSLEETKLYTGLEYDLSRENHREVIATVIRKLLNHILDNSEDDTKSLFLIIKIIGDL
LQFQGSHKHEFDSRWKSFNLVKKSMENRLHGKKQHIRALLIDRVMLQHELRTLTVEGCEY
KKIHQDMIRDLLRLSTSSYSQVRNKAQQTFFAALGAYNFCCRDIIPLVLEFLRPDRQDVT
QQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPAIVSSGLSQAMSLEKPSIVRLFDDLA
EKIHRQYETIGLDFTIPKSCVEIAELLQQSKNPSINQILLSPEKIKEGIKRQQEKNADAL
RNYENLVDTLLDGVEQRNLPWKFEHIGIGLLSLLLRDDRVLPLRAIRFFVENLNHDAIVV
RKMAISAVAGILKQLKRTHKKLTINPCEISGCPKPTQIIAGDRPDNHWLHYDSKTIPRTK
KEWESSCFVEKTHWGYYTWPKNMVVYAGVEEQPKLGRSREDMTEAEQIIFDHFSDPKFVE
QLITFLSLEDRKGKDKFNPRRFCLFKGIFRNFDDAFLPVLKPHLERLVADSHESTQRCVA
EIIAGLIRGSKHWTFEKVEKLWELLCPLLRTALSNITVETYNDWGACIATSCESRDPRKL
HWLFELLLESPLSGEGGSFVDACRLYVLQGGLAQQEWRVPELLHRLLKYLEPKLTQVYKN
VRERIGSVLTYIFMIDVSLPNTTPTISPHVPEFTARILEKLKPLMDVDEEIQNHVMEENG
IGEEDERTQGIKLLKTILKWLMASAGRSFSTAVTEQLQLLPLFFKIAPVENDNSYDELKR
DAKLCLSLMSQGLLYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNE
DAVKDIRWLVIIFWEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKR
KRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEM
TVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA
Download sequence
Identical sequences ENSPTRP00000020468 ENSPTRP00000020468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]