SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020654 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020654
Domain Number 1 Region: 42-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000221
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020654   Gene: ENSPTRG00000012031   Transcript: ENSPTRT00000022384
Sequence length 160
Comment pep:known chromosome:CHIMP2.1.4:2A:71403020:71509753:-1 gene:ENSPTRG00000012031 transcript:ENSPTRT00000022384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Download sequence
Identical sequences A0A2J8N499 P01135
ENSNLEP00000012418 ENSP00000295400 ENSP00000475235 gi|4507461|ref|NP_003227.1| 9606.ENSP00000295400 ENSNLEP00000012418 ENSPTRP00000020654 ENSPTRP00000020654 NP_003227.1.87134 NP_003227.1.92137 XP_001142892.1.37143 XP_003262568.1.23891 XP_018877140.1.27298 ENSP00000295400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]