SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020786 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020786
Domain Number 1 Region: 37-173
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-38
Family C-type lectin domain 0.000000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020786   Gene: ENSPTRG00000012116   Transcript: ENSPTRT00000022525
Sequence length 175
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:80217082:80219828:-1 gene:ENSPTRG00000012116 transcript:ENSPTRT00000022525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPMALPSVSWMLLSCLMLLSHVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKS
WTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW
EWSSSDVMNYFAWERNPSTVSSPGHCASLSRSTSFLRWKDYNCNVRLPYVCKFTD
Download sequence
Identical sequences H2QI82
XP_016804347.1.37143 ENSPTRP00000020786 ENSPTRP00000020786 9598.ENSPTRP00000020786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]