SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020813 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020813
Domain Number 1 Region: 43-153
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-20
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020813   Gene: ENSPTRG00000012133   Transcript: ENSPTRT00000022553
Sequence length 171
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:86622564:86624519:1 gene:ENSPTRG00000012133 transcript:ENSPTRT00000022553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYASSYPPPQQLSPRSRLCPSTPPQLNNLLLLEGRKSSVPSVAPTGSTSAAEDGDLLAQP
WYSGNCDRYAVESALLHLQKDGAYTVRPSSGPHGSQPFTLAVLLRGRVFNIPIRRLDGGR
HYALGREGRNHEELFSSVAAMVQHFMWHPLPLVDRHSGSRELTCLLFPTKP
Download sequence
Identical sequences ENSPTRP00000051866 ENSPTRP00000020813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]