SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021038 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021038
Domain Number 1 Region: 22-194
Classification Level Classification E-value
Superfamily Lysozyme-like 2.39e-18
Family G-type lysozyme 0.0000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021038   Gene: ENSPTRG00000012277   Transcript: ENSPTRT00000022799
Sequence length 194
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:99493572:99511963:-1 gene:ENSPTRG00000012277 transcript:ENSPTRT00000022799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALWLLLGLLALMDLSESSNWGCYGNIQSLDTPGASCGTGRRHGLNYCGVRASERLAEI
DMPYLLKYQPMMQTIGQKYCVDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTS
WISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCN
DVLARAKYLKRHGF
Download sequence
Identical sequences H2QIF1
ENSPTRP00000021038 9598.ENSPTRP00000021038 ENSPTRP00000021038 XP_016804596.1.37143 XP_016804597.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]