SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021175 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021175
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 137-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000109
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 3 Region: 221-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000149
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000021175
Domain Number - Region: 195-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 273-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00367
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021175   Gene: ENSPTRG00000012361   Transcript: ENSPTRT00000022953
Sequence length 439
Comment pep:known chromosome:CHIMP2.1.4:2A:112260868:112310328:1 gene:ENSPTRG00000012361 transcript:ENSPTRT00000022953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKS
RLAALQNSVSRVVPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVV
CLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAP
DGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLC
MHACVNTPGSYRCTCPSGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPE
CPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPVTLFRMATA
SAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLDR
SFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences H2QIJ7
XP_001143955.1.37143 ENSPTRP00000021175 ENSPTRP00000021175 9598.ENSPTRP00000021175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]