SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021283 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021283
Domain Number 1 Region: 152-451
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.47e-80
Family Eukaryotic proteases 0.00000000342
Further Details:      
 
Domain Number 2 Region: 42-97
Classification Level Classification E-value
Superfamily GLA-domain 1.58e-19
Family GLA-domain 0.00032
Further Details:      
 
Domain Number 3 Region: 98-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021283   Gene: ENSPTRG00000012428   Transcript: ENSPTRT00000023076
Sequence length 461
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:128114653:128125481:1 gene:ENSPTRG00000012428 transcript:ENSPTRT00000023076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCQPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
Download sequence
Identical sequences H2QIN8
XP_515775.3.37143 ENSPTRP00000021283 ENSPTRP00000021283 9598.ENSPTRP00000021283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]