SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021322 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021322
Domain Number 1 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000461
Family Cripto EGF-like domain-like 0.004
Further Details:      
 
Domain Number 2 Region: 87-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000205
Family EGF-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021322   Gene: ENSPTRG00000012455   Transcript: ENSPTRT00000023119
Sequence length 223
Comment pep:novel chromosome:CHIMP2.1.4:2B:131259140:131266070:1 gene:ENSPTRG00000012455 transcript:ENSPTRT00000023119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVIKVATQKHQQSPLNWTSSHFGE
VTGSAEGWGPEEPLTYSWAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRR
SECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGPSAGGAPSLLL
LLPCALLHRLLRPDAPAHPRSLVPSVLQRERRPCGRPGLGHRL
Download sequence
Identical sequences A0A2I3TQH1
ENSPTRP00000021322 ENSPTRP00000021322 XP_001144170.1.37143 9598.ENSPTRP00000021322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]