SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021795 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021795
Domain Number 1 Region: 317-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.64e-109
Family STAT DNA-binding domain 0.000000000254
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 3.14e-65
Family STAT 0.0000000092
Further Details:      
 
Domain Number 3 Region: 569-710
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-44
Family SH2 domain 0.0000000878
Further Details:      
 
Domain Number 4 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 3.66e-44
Family Transcription factor STAT-4 N-domain 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021795   Gene: ENSPTRG00000012749   Transcript: ENSPTRT00000023629
Sequence length 750
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:195627814:195673425:-1 gene:ENSPTRG00000012749 transcript:ENSPTRT00000023629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLPDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
Download sequence
Identical sequences ENSPTRP00000021795 ENSPTRP00000021795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]