SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021908 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021908
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-22
Family Ubiquitin-related 0.0000117
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000021908
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0108
Family Ubiquitin-related 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021908   Gene: ENSPTRG00000012817   Transcript: ENSPTRT00000023767
Sequence length 146
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:206969373:207002841:-1 gene:ENSPTRG00000012817 transcript:ENSPTRT00000023767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKEAQWPTPAIPALWEAEAGWITAGQELRPAWATGRNLISTKNR
KSSQLGMEEEDVIEVYQEQTGGHSTV
Download sequence
Identical sequences A0A2I3TI94
ENSPTRP00000021908 ENSPTRP00000021908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]