SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021954 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021954
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000641
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000175
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.0000199
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 5 Region: 642-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.97e-28
Family MAM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021954   Gene: ENSPTRG00000012839   Transcript: ENSPTRT00000023814
Sequence length 931
Comment pep:known chromosome:CHIMP2.1.4:2B:210508982:210624383:1 gene:ENSPTRG00000012839 transcript:ENSPTRT00000023814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMLPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSML
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPTEEEATECGENCSFEDDKDLQLPSGFNCNFDFPEEPCGWMYD
HAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSRREGQYARLISPPVHLPRSPVCMEFQY
QATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNS
SSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSR
SCTTLENYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences H2QJA3
ENSPTRP00000021954 XP_016805849.1.37143 XP_016805850.1.37143 9598.ENSPTRP00000021954 ENSPTRP00000021954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]