SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022079 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000022079
Domain Number - Region: 14-69
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00837
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022079   Gene: ENSPTRG00000012915   Transcript: ENSPTRT00000023944
Sequence length 311
Comment pep:known chromosome:CHIMP2.1.4:2B:223330349:223348694:-1 gene:ENSPTRG00000012915 transcript:ENSPTRT00000023944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPI
NPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF
TFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTG
TISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSIV
LYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIIYIF
TFVLQLMGDRN
Download sequence
Identical sequences H2QJE5
ENSPTRP00000022079 9598.ENSPTRP00000022079 XP_001144519.2.37143 XP_003818647.1.60992 XP_003818648.1.60992 XP_003950021.1.37143 XP_008970182.1.60992 XP_009442563.1.37143 XP_009442564.1.37143 XP_009442566.1.37143 ENSPTRP00000022079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]