SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022087 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022087
Domain Number 1 Region: 26-283
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000699
Family Armadillo repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022087   Gene: ENSPTRG00000012921   Transcript: ENSPTRT00000023953
Sequence length 331
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:223631524:223659019:1 gene:ENSPTRG00000012921 transcript:ENSPTRT00000023953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSF
GTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLY
PFLHTVSKTRPFEYLRLTSLGVIVETGFHHVGQADLELLTSSDLPASASQSAGITGALVK
TDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSH
VAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQVLKD
DTTTKRWLAQLVKNLQEGQVTDPRGIPLPPQ
Download sequence
Identical sequences A0A2I3RD82
ENSPTRP00000022087 ENSPTRP00000022087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]