SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022117 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022117
Domain Number 1 Region: 29-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.51e-98
Family Glycosyl hydrolases family 35 catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 474-633
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.07e-30
Family Beta-galactosidase LacA, domains 4 and 5 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022117   Gene: ENSPTRG00000012947   Transcript: ENSPTRT00000023985
Sequence length 654
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:224315538:224324863:-1 gene:ENSPTRG00000012947 transcript:ENSPTRT00000023985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKLSCLRSLLLPLSLTLLLPQADTRSFVVNRGHDRFLLDSAPFRYVSGSLHYFRVPR
VLWGDRLLKMRWSGLNAIQFYVPWNYHEPQPGVYNFNGSRDLIAFLNEAALANLLVILRP
GPYICAEWEMGGLPSWLLRKPEIHLRTSDPDFLAAVDSWFKVLLPKIHPWLYHNGGNIIS
IQVENEYGSYRACDFSYMRHLAGLFRALLGEKILLFTTDGPEGLKCGSLQGLYTTVDFGP
ADNMTKIFTLLRKYEPHGPLVNSEYYTGWLDYWGQNHSTRSVSAVTKGLENMLKLGASVN
MYMFHGGTNFGYWNGADKKGRFLPITTSYDYDAPISEAGDPTPKLFALRDVISKFQEVPL
GPLPPPSPKMMLGPVTLHLVGHLLAFLDLLCPRGPIHSILPMTFEAVKQDHGFMLYRTYM
THTIFEPTPFWVPNNGVHDRAYVMVDGVFQGVLERNMRDKLFLTGKLGSKLDILVENMGR
LSFGSNSSDFKGLLKPPILGQTILTQWMMFPLKIDNLVKWWFPLQLPKWPYPQAPYGPTF
YSKTFPILGSVGDTFLYLPGWTKGQVWINGFNLGRYWTKQGPQQTLYVPRFLLFPRGALN
KITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH
Download sequence
Identical sequences ENSPTRP00000022117 ENSPTRP00000022117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]