SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022158 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022158
Domain Number 1 Region: 613-907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.97e-83
Family Protein kinases, catalytic subunit 0.000000000528
Further Details:      
 
Domain Number 2 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.66e-75
Family Ephrin receptor ligand binding domain 0.000000746
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 9.53e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 910-982
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.99e-20
Family SAM (sterile alpha motif) domain 0.0000452
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000022158
Domain Number - Region: 259-330,366-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000863
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022158   Gene: ENSPTRG00000012967   Transcript: ENSPTRT00000024029
Sequence length 986
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:226508896:226655853:-1 gene:ENSPTRG00000012967 transcript:ENSPTRT00000024029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAIT
HQNKILSSVQAMRTQMQQMHGRMVPV
Download sequence
Identical sequences A0A024R452 A0A2I3TA69 P54764
ENSPTRP00000022158 9598.ENSPTRP00000022158 9606.ENSP00000281821 ENSP00000281821 ENSP00000386829 ENSGGOP00000014427 ENSGGOP00000014427 ENSPTRP00000022158 NP_001291465.1.87134 NP_001291465.1.92137 NP_004429.1.87134 NP_004429.1.92137 XP_001164828.2.37143 XP_009442671.1.37143 XP_014199572.1.60992 XP_014199573.1.60992 gi|4758280|ref|NP_004429.1| ENSP00000281821 ENSP00000386829 ENSP00000281821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]